PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A04G1024
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 246aa    MW: 27610.6 Da    PI: 7.1338
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A04G1024genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.61.9e-20953146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W++eEdell ++v+++G ++W++++r ++ gR++k+c++rw +
      Gh_A04G1024  9 KGPWSPEEDELLRKLVHRHGARNWSLVSRSIP-GRSGKSCRLRWCN 53
                     79******************************.***********87 PP

2Myb_DNA-binding53.94e-1763105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T eEd  +v+a++++G++ W+tIar ++ gRt++ +k++w++ 
      Gh_A04G1024  63 AFTSEEDGVIVKAHAKYGNK-WATIARLLN-GRTDNAVKNHWNST 105
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.439459IPR017930Myb domain
SuperFamilySSF466891.65E-306102IPR009057Homeodomain-like
SMARTSM007171.0E-16857IPR001005SANT/Myb domain
PfamPF002491.1E-19953IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-251062IPR009057Homeodomain-like
CDDcd001671.88E-141153No hitNo description
SMARTSM007178.8E-1360108IPR001005SANT/Myb domain
PROSITE profilePS5129420.64161110IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2263110IPR009057Homeodomain-like
CDDcd001679.73E-963106No hitNo description
PfamPF002491.3E-1363105IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MDQDVDRVKG PWSPEEDELL RKLVHRHGAR NWSLVSRSIP GRSGKSCRLR WCNQISPEVE  60
HRAFTSEEDG VIVKAHAKYG NKWATIARLL NGRTDNAVKN HWNSTLKRKL SEAEDGDSVQ  120
ESEKRSAKSP RRESPSGSEV SDLGLSVAKS NRHSADVVST ELTLGRSWNE SFEFNNSSSS  180
EKKNEQPLEE KQVAGANMTT VALAQAATAA ITPAAMQEMI RKEVRDYMAE FDCKSENVRD  240
LWGRED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-3861104108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461001.11e-153PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW18e-64MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2V6S91e-153A0A0D2V6S9_G
STRINGPOPTR_0009s09890.15e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-64myb domain protein 73